PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00568.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 282aa    MW: 32309.4 Da    PI: 8.9859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00568.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-1658103147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W   Ed +lv++v+ +G+ +W+ Ia++m+ gRt+k+c++rw++ 
  Rsa1.0_00568.1_g00012.1  58 RGHWKISEDSQLVELVAVYGPQNWNHIAEKMQ-GRTGKSCRLRWFNQ 103
                              799*****************************.***********996 PP

2Myb_DNA-binding47.25e-15111154247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +++ eE+e+l+ a++ +G++ W+ Ia+ +  gRt++ +k++w+ +
  Rsa1.0_00568.1_g00012.1 111 RAFSVEEEERLLAAHRAFGNK-WAMIAKIFD-GRTDNALKNHWHVL 154
                              689******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.68953104IPR017930Myb domain
SMARTSM007172.1E-1257106IPR001005SANT/Myb domain
SuperFamilySSF466892.1E-2758151IPR009057Homeodomain-like
PfamPF002491.3E-1558103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2459111IPR009057Homeodomain-like
CDDcd001673.50E-1161102No hitNo description
PROSITE profilePS5129425.167105159IPR017930Myb domain
SMARTSM007171.9E-12109157IPR001005SANT/Myb domain
PfamPF002492.6E-11111154IPR001005SANT/Myb domain
CDDcd001679.93E-9112155No hitNo description
Gene3DG3DSA:1.10.10.604.3E-19112159IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDISCFQKYP FDLPCSRAFN GDGEYNAVEF SNKRRMVKVS DESKNKKKKQ RGSRVCSRGH  60
WKISEDSQLV ELVAVYGPQN WNHIAEKMQG RTGKSCRLRW FNQLDPRINK RAFSVEEEER  120
LLAAHRAFGN KWAMIAKIFD GRTDNALKNH WHVLMARKLR QQSTSYMRRF NGSAHKPNAD  180
HKSFNHSPGS VDDEDMNLED NSWKMLNEET TNLKEEYCSS RMPMQAPHHY YSALSADSLA  240
LTLHVSIQEP SSSLSSLSLP PSSAEPPAFI DFLGVCHQSP NI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-30581594105MYB PROTO-ONCOGENE PROTEIN
1h8a_C7e-305715926128MYB TRANSFORMING PROTEIN
1mse_C3e-30581594105C-Myb DNA-Binding Domain
1msf_C3e-30581594105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13248KRRMVKVSDESKNKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610833.11e-164PREDICTED: transcription factor MYB57-like
TrEMBLA0A0D3E0M01e-164A0A0D3E0M0_BRAOL; Uncharacterized protein
STRINGscaffold_500894.11e-145(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-128myb domain protein 110